Lineage for d1sfci_ (1sfc I:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 344850Fold h.1: Parallel coiled-coil [57943] (26 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 345390Superfamily h.1.15: SNARE fusion complex [58038] (1 family) (S)
    tetrameric parallel coiled coil
  5. 345391Family h.1.15.1: SNARE fusion complex [58039] (10 proteins)
  6. 345401Protein Synaptobrevin [88903] (2 species)
  7. 345404Species Rat (Rattus norvegicus) [TaxId:10116] [88904] (3 PDB entries)
  8. 345408Domain d1sfci_: 1sfc I: [45651]
    Other proteins in same PDB: d1sfcb_, d1sfcc_, d1sfcd_, d1sfcf_, d1sfcg_, d1sfch_, d1sfcj_, d1sfck_, d1sfcl_
    complex with syntaxin and SNAP-25 fragments

Details for d1sfci_

PDB Entry: 1sfc (more details), 2.4 Å

PDB Description: neuronal synaptic fusion complex

SCOP Domain Sequences for d1sfci_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfci_ h.1.15.1 (I:) Synaptobrevin {Rat (Rattus norvegicus)}
ltsnrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaaklk
rkywwknlk

SCOP Domain Coordinates for d1sfci_:

Click to download the PDB-style file with coordinates for d1sfci_.
(The format of our PDB-style files is described here.)

Timeline for d1sfci_: