Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (38 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.15: SNARE fusion complex [58038] (2 families) tetrameric parallel coiled coil |
Family h.1.15.1: SNARE fusion complex [58039] (12 proteins) |
Protein Synaptosomal-associated protein SNAP-25 [88915] (3 species) provides up to two different helical regions to synaptic fusion complexes |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88916] (7 PDB entries) Uniprot P13795 7-83; 142-204 # identical sequences to human species |
Domain d1sfch_: 1sfc H: [45650] Other proteins in same PDB: d1sfca_, d1sfcb_, d1sfce_, d1sfcf_, d1sfci_, d1sfcj_ complex with synaptobrevin and syntaxin fragments complexed with mpd, sr |
PDB Entry: 1sfc (more details), 2.4 Å
SCOPe Domain Sequences for d1sfch_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sfch_ h.1.15.1 (H:) Synaptosomal-associated protein SNAP-25 {Norway rat (Rattus norvegicus) [TaxId: 10116]} gfirrvtndarenemdenleqvsgiignlrhmaldmgneidtqnrqidrimekadsnktr ideanqratkml
Timeline for d1sfch_: