Lineage for d1sfch_ (1sfc H:)

  1. Root: SCOP 1.69
  2. 525081Class h: Coiled coil proteins [57942] (6 folds)
  3. 525082Fold h.1: Parallel coiled-coil [57943] (28 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 525700Superfamily h.1.15: SNARE fusion complex [58038] (1 family) (S)
    tetrameric parallel coiled coil
  5. 525701Family h.1.15.1: SNARE fusion complex [58039] (11 proteins)
  6. 525726Protein Synaptosomal-associated protein SNAP-25 [88915] (3 species)
    provides up to two different helical regions to synaptic fusion complexes
  7. 525733Species Rat (Rattus norvegicus) [TaxId:10116] [88916] (4 PDB entries)
    identical sequences to human species
  8. 525743Domain d1sfch_: 1sfc H: [45650]
    Other proteins in same PDB: d1sfca_, d1sfcb_, d1sfce_, d1sfcf_, d1sfci_, d1sfcj_

Details for d1sfch_

PDB Entry: 1sfc (more details), 2.4 Å

PDB Description: neuronal synaptic fusion complex

SCOP Domain Sequences for d1sfch_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfch_ h.1.15.1 (H:) Synaptosomal-associated protein SNAP-25 {Rat (Rattus norvegicus)}
gfirrvtndarenemdenleqvsgiignlrhmaldmgneidtqnrqidrimekadsnktr
ideanqratkml

SCOP Domain Coordinates for d1sfch_:

Click to download the PDB-style file with coordinates for d1sfch_.
(The format of our PDB-style files is described here.)

Timeline for d1sfch_: