Lineage for d1sfce_ (1sfc E:)

  1. Root: SCOP 1.63
  2. 271841Class h: Coiled coil proteins [57942] (6 folds)
  3. 271842Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 272361Superfamily h.1.15: Neuronal synaptic fusion complex [58038] (1 family) (S)
    tetrameric parallel coiled coil
  5. 272362Family h.1.15.1: Neuronal synaptic fusion complex [58039] (1 protein)
  6. 272363Protein Neuronal synaptic fusion complex [58040] (4 species)
  7. 272381Species Rat (Rattus norvegicus) [TaxId:10116] [58041] (4 PDB entries)
  8. 272398Domain d1sfce_: 1sfc E: [45647]

Details for d1sfce_

PDB Entry: 1sfc (more details), 2.4 Å

PDB Description: neuronal synaptic fusion complex

SCOP Domain Sequences for d1sfce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfce_ h.1.15.1 (E:) Neuronal synaptic fusion complex {Rat (Rattus norvegicus)}
snrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaaklkrk
ywwknlkmm

SCOP Domain Coordinates for d1sfce_:

Click to download the PDB-style file with coordinates for d1sfce_.
(The format of our PDB-style files is described here.)

Timeline for d1sfce_: