Class h: Coiled coil proteins [57942] (6 folds) |
Fold h.1: Parallel coiled-coil [57943] (22 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.15: Neuronal synaptic fusion complex [58038] (1 family) tetrameric parallel coiled coil |
Family h.1.15.1: Neuronal synaptic fusion complex [58039] (1 protein) |
Protein Neuronal synaptic fusion complex [58040] (4 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [58041] (4 PDB entries) |
Domain d1sfce_: 1sfc E: [45647] |
PDB Entry: 1sfc (more details), 2.4 Å
SCOP Domain Sequences for d1sfce_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sfce_ h.1.15.1 (E:) Neuronal synaptic fusion complex {Rat (Rattus norvegicus)} snrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaaklkrk ywwknlkmm
Timeline for d1sfce_: