Lineage for d1sfcb_ (1sfc B:)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.1: Parallel coiled-coil [57943] (19 superfamilies)
  4. Superfamily h.1.15: Neuronal synaptic fusion complex [58038] (1 family) (S)
  5. Family h.1.15.1: Neuronal synaptic fusion complex [58039] (1 protein)
  6. Protein Neuronal synaptic fusion complex [58040] (1 species)
  7. Species Rat (Rattus norvegicus) [TaxId:10116] [58041] (2 PDB entries)
  8. Domain d1sfcb_: 1sfc B: [45644]

Details for d1sfcb_

PDB Entry: 1sfc (more details), 2.4 Å

PDB Description: neuronal synaptic fusion complex

SCOP Domain Sequences for d1sfcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfcb_ h.1.15.1 (B:) Neuronal synaptic fusion complex {Rat (Rattus norvegicus)}
skqalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyvera
vsdtkkavkyqs

SCOP Domain Coordinates for d1sfcb_ are not available.

Timeline for d1sfcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sfca_, d1sfcc_, d1sfcd_, d1sfce_, d1sfcf_, d1sfcg_, d1sfch_, d1sfci_, d1sfcj_, d1sfck_, d1sfcl_