Lineage for d1sfca_ (1sfc A:)

  1. Root: SCOP 1.67
  2. 431023Class h: Coiled coil proteins [57942] (6 folds)
  3. 431024Fold h.1: Parallel coiled-coil [57943] (27 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 431612Superfamily h.1.15: SNARE fusion complex [58038] (1 family) (S)
    tetrameric parallel coiled coil
  5. 431613Family h.1.15.1: SNARE fusion complex [58039] (10 proteins)
  6. 431623Protein Synaptobrevin [88903] (2 species)
  7. 431626Species Rat (Rattus norvegicus) [TaxId:10116] [88904] (3 PDB entries)
  8. 431629Domain d1sfca_: 1sfc A: [45643]
    Other proteins in same PDB: d1sfcb_, d1sfcc_, d1sfcd_, d1sfcf_, d1sfcg_, d1sfch_, d1sfcj_, d1sfck_, d1sfcl_

Details for d1sfca_

PDB Entry: 1sfc (more details), 2.4 Å

PDB Description: neuronal synaptic fusion complex

SCOP Domain Sequences for d1sfca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfca_ h.1.15.1 (A:) Synaptobrevin {Rat (Rattus norvegicus)}
nltsnrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaakl
krkywwknl

SCOP Domain Coordinates for d1sfca_:

Click to download the PDB-style file with coordinates for d1sfca_.
(The format of our PDB-style files is described here.)

Timeline for d1sfca_: