Class h: Coiled coil proteins [57942] (6 folds) |
Fold h.1: Parallel coiled-coil [57943] (26 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.15: SNARE fusion complex [58038] (1 family) tetrameric parallel coiled coil |
Family h.1.15.1: SNARE fusion complex [58039] (10 proteins) |
Protein Synaptobrevin [88903] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [88904] (3 PDB entries) |
Domain d1sfca_: 1sfc A: [45643] Other proteins in same PDB: d1sfcb_, d1sfcc_, d1sfcd_, d1sfcf_, d1sfcg_, d1sfch_, d1sfcj_, d1sfck_, d1sfcl_ |
PDB Entry: 1sfc (more details), 2.4 Å
SCOP Domain Sequences for d1sfca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sfca_ h.1.15.1 (A:) Synaptobrevin {Rat (Rattus norvegicus)} nltsnrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaakl krkywwknl
Timeline for d1sfca_: