Lineage for d1hvva_ (1hvv A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040219Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 3040220Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 3040293Protein Syntaxin 1A [88908] (3 species)
  7. 3040300Species Norway rat (Rattus norvegicus) [TaxId:10116] [88909] (6 PDB entries)
    Uniprot P32851 196-259
    a globular structure of a larger fragment containing this region is available; seepdb:1dn1, chain B
  8. 3040302Domain d1hvva_: 1hvv A: [45639]
    Self-association H3 region of syntaxin 1A
    complexed with tar

Details for d1hvva_

PDB Entry: 1hvv (more details), 2.4 Å

PDB Description: self-association of the h3 region of syntaxin 1a: implications for snare complex assembly
PDB Compounds: (A:) syntaxin 1a

SCOPe Domain Sequences for d1hvva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hvva_ h.1.15.1 (A:) Syntaxin 1A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyveravs
dtkkavk

SCOPe Domain Coordinates for d1hvva_:

Click to download the PDB-style file with coordinates for d1hvva_.
(The format of our PDB-style files is described here.)

Timeline for d1hvva_: