Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (38 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
Protein Fibrinogen beta chain [88892] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries) Uniprot P02675 |
Domain d1fzab2: 1fza B:148-199 [45621] Other proteins in same PDB: d1fzaa_, d1fzab1, d1fzac1, d1fzac2, d1fzad_, d1fzae1, d1fzaf1, d1fzaf2 coiled-coil region only complexed with ca, nag |
PDB Entry: 1fza (more details), 2.9 Å
SCOPe Domain Sequences for d1fzab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzab2 h.1.8.1 (B:148-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]} khqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv
Timeline for d1fzab2: