Lineage for d1fzab2 (1fza B:148-199)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266165Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 2266166Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 2266231Protein Fibrinogen beta chain [88892] (4 species)
  7. 2266240Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries)
    Uniprot P02675
  8. 2266265Domain d1fzab2: 1fza B:148-199 [45621]
    Other proteins in same PDB: d1fzaa_, d1fzab1, d1fzac1, d1fzac2, d1fzad_, d1fzae1, d1fzaf1, d1fzaf2
    coiled-coil region only
    complexed with ca, nag

Details for d1fzab2

PDB Entry: 1fza (more details), 2.9 Å

PDB Description: crystal structure of fibrinogen fragment d
PDB Compounds: (B:) fibrinogen

SCOPe Domain Sequences for d1fzab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzab2 h.1.8.1 (B:148-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]}
khqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv

SCOPe Domain Coordinates for d1fzab2:

Click to download the PDB-style file with coordinates for d1fzab2.
(The format of our PDB-style files is described here.)

Timeline for d1fzab2: