Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (38 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
Protein Fibrinogen gamma chain [88898] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries) Uniprot P02679 |
Domain d1fzec2: 1fze C:92-141 [45616] Other proteins in same PDB: d1fzea_, d1fzeb1, d1fzeb2, d1fzec1, d1fzed_, d1fzee1, d1fzee2, d1fzef1 coiled-coil region only complexed with ca, nag |
PDB Entry: 1fze (more details), 3 Å
SCOPe Domain Sequences for d1fzec2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzec2 h.1.8.1 (C:92-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]} eimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckd
Timeline for d1fzec2: