Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
Protein Fibrinogen gamma chain [88898] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries) Uniprot P02679 |
Domain d1fzbf2: 1fzb F:88-141 [45613] Other proteins in same PDB: d1fzba_, d1fzbb1, d1fzbb2, d1fzbc1, d1fzbd_, d1fzbe1, d1fzbe2, d1fzbf1 coiled-coil region only complexed with ca, nag |
PDB Entry: 1fzb (more details), 2.9 Å
SCOPe Domain Sequences for d1fzbf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzbf2 h.1.8.1 (F:88-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]} kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckd
Timeline for d1fzbf2: