Lineage for d1fzbf2 (1fzb F:88-141)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039948Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 3039949Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 3040061Protein Fibrinogen gamma chain [88898] (4 species)
  7. 3040070Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries)
    Uniprot P02679
  8. 3040093Domain d1fzbf2: 1fzb F:88-141 [45613]
    Other proteins in same PDB: d1fzba_, d1fzbb1, d1fzbb2, d1fzbc1, d1fzbd_, d1fzbe1, d1fzbe2, d1fzbf1
    coiled-coil region only
    complexed with ca, nag

Details for d1fzbf2

PDB Entry: 1fzb (more details), 2.9 Å

PDB Description: crystal structure of crosslinked fragment d
PDB Compounds: (F:) fibrinogen

SCOPe Domain Sequences for d1fzbf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzbf2 h.1.8.1 (F:88-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]}
kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckd

SCOPe Domain Coordinates for d1fzbf2:

Click to download the PDB-style file with coordinates for d1fzbf2.
(The format of our PDB-style files is described here.)

Timeline for d1fzbf2: