Lineage for d1fzbb2 (1fzb B:148-199)

  1. Root: SCOP 1.63
  2. 271841Class h: Coiled coil proteins [57942] (6 folds)
  3. 271842Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 272214Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 272215Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein)
  6. 272216Protein Fibrinogen coiled-coil and central regions [58012] (4 species)
    in the central region two tripple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  7. 272237Species Human (Homo sapiens) [TaxId:9606] [58013] (10 PDB entries)
  8. 272269Domain d1fzbb2: 1fzb B:148-199 [45609]
    Other proteins in same PDB: d1fzbb1, d1fzbc1, d1fzbe1, d1fzbf1

Details for d1fzbb2

PDB Entry: 1fzb (more details), 2.9 Å

PDB Description: crystal structure of crosslinked fragment d

SCOP Domain Sequences for d1fzbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzbb2 h.1.8.1 (B:148-199) Fibrinogen coiled-coil and central regions {Human (Homo sapiens)}
khqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv

SCOP Domain Coordinates for d1fzbb2:

Click to download the PDB-style file with coordinates for d1fzbb2.
(The format of our PDB-style files is described here.)

Timeline for d1fzbb2: