SCOPe 2.06: Domain d1fzgf2: 1fzg F:109-141

Lineage for d1fzgf2 (1fzg F:109-141)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen gamma chain [88898] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries)
   Uniprot P02679

8. Domain d1fzgf2: 1fzg F:109-141 [45607]
   Other proteins in same PDB: d1fzga_, d1fzgb1, d1fzgb2, d1fzgc1, d1fzgd_, d1fzge1, d1fzge2, d1fzgf1
   complexed with ca

Details for d1fzgf2

PDB Entry: 1fzg, 2.5 Å

PDB Description: crystal structure of fragment d from human fibrinogen with the peptide ligand gly-his-arg-pro-amide

PDB Compounds: (F:) fibrinogen

SCOPe Domain Sequences for d1fzgf2:

Sequence; same for both SEQRES and ATOM records:

>d1fzgf2 h.1.8.1 (F:109-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]}
ylqeiynsnnqkivnlkekvaqleaqcqepckd

Timeline for d1fzgf2:

• d1fzgf2 first appeared (with stable ids) in SCOP 1.55
  
• d1fzgf2 appears in SCOPe 2.05
  
• d1fzgf2 appears in SCOPe 2.07
  
• d1fzgf2 appears in the current release, SCOPe 2.08