Lineage for d1fzgd1 (1fzg D:)

  1. Root: SCOP 1.61
  2. 205390Class h: Coiled coil proteins [57942] (5 folds)
  3. 205391Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
  4. 205752Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 205753Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein)
  6. 205754Protein Fibrinogen coiled-coil and central regions [58012] (4 species)
  7. 205775Species Human (Homo sapiens) [TaxId:9606] [58013] (6 PDB entries)
  8. 205791Domain d1fzgd1: 1fzg D: [45605]
    Other proteins in same PDB: d1fzgb1, d1fzgc1, d1fzge1, d1fzgf1

Details for d1fzgd1

PDB Entry: 1fzg (more details), 2.5 Å

PDB Description: crystal structure of fragment d from human fibrinogen with the peptide ligand gly-his-arg-pro-amide

SCOP Domain Sequences for d1fzgd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzgd1 h.1.8.1 (D:) Fibrinogen coiled-coil and central regions {Human (Homo sapiens)}
llqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkqleqv

SCOP Domain Coordinates for d1fzgd1:

Click to download the PDB-style file with coordinates for d1fzgd1.
(The format of our PDB-style files is described here.)

Timeline for d1fzgd1: