SCOP 1.71: Domain d1fzgc2: 1fzg C:102-141

Lineage for d1fzgc2 (1fzg C:102-141)

1. Root: SCOP 1.71

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (29 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen gamma chain [88898] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88900] (15 PDB entries)

8. Domain d1fzgc2: 1fzg C:102-141 [45604]
   Other proteins in same PDB: d1fzga_, d1fzgb1, d1fzgb2, d1fzgc1, d1fzgd_, d1fzge1, d1fzge2, d1fzgf1

Details for d1fzgc2

PDB Entry: 1fzg, 2.5 Å

PDB Description: crystal structure of fragment d from human fibrinogen with the peptide ligand gly-his-arg-pro-amide

SCOP Domain Sequences for d1fzgc2:

Sequence; same for both SEQRES and ATOM records:

>d1fzgc2 h.1.8.1 (C:102-141) Fibrinogen gamma chain {Human (Homo sapiens)}
thdssirylqeiynsnnqkivnlkekvaqleaqcqepckd

Timeline for d1fzgc2:

• d1fzgc2 first appeared (with stable ids) in SCOP 1.55
  
• d1fzgc2 appears in SCOP 1.69
  
• d1fzgc2 appears in SCOP 1.73
  
• d1fzgc2 appears in the current release, SCOPe 2.08