SCOP 1.59: Domain d1fzgc2: 1fzg C:102-141

Lineage for d1fzgc2 (1fzg C:102-141)

1. Root: SCOP 1.59

2. Class h: Coiled coil proteins [57942] (5 folds)

3. Fold h.1: Parallel coiled-coil [57943] (21 superfamilies)

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein)

6. Protein Fibrinogen coiled-coil and central regions [58012] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [58013] (6 PDB entries)

8. Domain d1fzgc2: 1fzg C:102-141 [45604]
   Other proteins in same PDB: d1fzgb1, d1fzgc1, d1fzge1, d1fzgf1

Details for d1fzgc2

PDB Entry: 1fzg, 2.5 Å

PDB Description: crystal structure of fragment d from human fibrinogen with the peptide ligand gly-his-arg-pro-amide

SCOP Domain Sequences for d1fzgc2:

Sequence; same for both SEQRES and ATOM records:

>d1fzgc2 h.1.8.1 (C:102-141) Fibrinogen coiled-coil and central regions {Human (Homo sapiens)}
thdssirylqeiynsnnqkivnlkekvaqleaqcqepckd

Timeline for d1fzgc2:

• d1fzgc2 first appeared (with stable ids) in SCOP 1.55
  
• d1fzgc2 appears in SCOP 1.57
  
• d1fzgc2 appears in SCOP 1.61
  
• d1fzgc2 appears in the current release, SCOPe 2.08