Lineage for d1fzga_ (1fzg A:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 344850Fold h.1: Parallel coiled-coil [57943] (26 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 345233Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 345234Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two tripple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 345235Protein Fibrinogen alpha chain [88887] (4 species)
  7. 345244Species Human (Homo sapiens) [TaxId:9606] [88889] (10 PDB entries)
  8. 345251Domain d1fzga_: 1fzg A: [45602]
    Other proteins in same PDB: d1fzgb1, d1fzgb2, d1fzgc1, d1fzgc2, d1fzge1, d1fzge2, d1fzgf1, d1fzgf2

Details for d1fzga_

PDB Entry: 1fzg (more details), 2.5 Å

PDB Description: crystal structure of fragment d from human fibrinogen with the peptide ligand gly-his-arg-pro-amide

SCOP Domain Sequences for d1fzga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzga_ h.1.8.1 (A:) Fibrinogen alpha chain {Human (Homo sapiens)}
viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
eqviakd

SCOP Domain Coordinates for d1fzga_:

Click to download the PDB-style file with coordinates for d1fzga_.
(The format of our PDB-style files is described here.)

Timeline for d1fzga_: