SCOP 1.55: Domain d1fzga1: 1fzg A:

Lineage for d1fzga1 (1fzg A:)

1. Root: SCOP 1.55
2. Class h: Coiled coil proteins [57942] (5 folds)
3. Fold h.1: Parallel coiled-coil [57943] (19 superfamilies)
4. Superfamily h.1.8: Fibrinogen coiled-coil region [58010] (1 family)
5. Family h.1.8.1: Fibrinogen coiled-coil region [58011] (1 protein)
6. Protein Fibrinogen coiled-coil region [58012] (1 species)
7. Species Human (Homo sapiens) [TaxId:9606] [58013] (6 PDB entries)
8. Domain d1fzga1: 1fzg A: [45602]
   Other proteins in same PDB: d1fzgb1, d1fzgc1, d1fzge1, d1fzgf1

Details for d1fzga1

PDB Entry: 1fzg, 2.5 Å

PDB Description: crystal structure of fragment d from human fibrinogen with the peptide ligand gly-his-arg-pro-amide

SCOP Domain Sequences for d1fzga1:

Sequence; same for both SEQRES and ATOM records:

>d1fzga1 h.1.8.1 (A:) Fibrinogen coiled-coil region {Human (Homo sapiens)}
viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
eqviakd

SCOP Domain Coordinates for d1fzga1 are not available.

Timeline for d1fzga1:

• d1fzga1 appears in SCOP 1.57
  
• d1fzga1 appears in the current release, SCOPe 2.08, called d1fzga_