SCOP 1.63: Domain d1fzfd_: 1fzf D:

Lineage for d1fzfd_ (1fzf D:)

1. Root: SCOP 1.63

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein)

6. Protein Fibrinogen coiled-coil and central regions [58012] (4 species)
   in the central region two tripple coiled-coils are stacked end-to-end and interlock with N-terminal tails

7. Species Human (Homo sapiens) [TaxId:9606] [58013] (10 PDB entries)

8. Domain d1fzfd_: 1fzf D: [45599]
   Other proteins in same PDB: d1fzfb1, d1fzfc1, d1fzfe1, d1fzff1
   complexed with ca, nag

Details for d1fzfd_

PDB Entry: 1fzf, 2.7 Å

PDB Description: crystal structure of fragment double-d from human fibrin with the peptide ligand gly-his-arg-pro-amide

SCOP Domain Sequences for d1fzfd_:

Sequence; same for both SEQRES and ATOM records:

>d1fzfd_ h.1.8.1 (D:) Fibrinogen coiled-coil and central regions {Human (Homo sapiens)}
llqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkqleqv

Timeline for d1fzfd_:

• d1fzfd_ first appeared (with stable ids) in SCOP 1.55, called d1fzfd1
  
• d1fzfd_ was called d1fzfd1 in SCOP 1.61
  
• d1fzfd_ appears in SCOP 1.65
  
• d1fzfd_ appears in the current release, SCOPe 2.08