SCOP 1.75: Domain d1fzfc2: 1fzf C:102-141

Lineage for d1fzfc2 (1fzf C:102-141)

1. Root: SCOP 1.75

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen gamma chain [88898] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries)
   Uniprot P02679

8. Domain d1fzfc2: 1fzf C:102-141 [45598]
   Other proteins in same PDB: d1fzfa_, d1fzfb1, d1fzfb2, d1fzfc1, d1fzfd_, d1fzfe1, d1fzfe2, d1fzff1
   coiled-coil region only

Details for d1fzfc2

PDB Entry: 1fzf, 2.7 Å

PDB Description: crystal structure of fragment double-d from human fibrin with the peptide ligand gly-his-arg-pro-amide

PDB Compounds: (C:) fibrinogen

SCOP Domain Sequences for d1fzfc2:

Sequence; same for both SEQRES and ATOM records:

>d1fzfc2 h.1.8.1 (C:102-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]}
thdssirylqeiynsnnqkivnlkekvaqleaqcqepckd

Timeline for d1fzfc2:

• d1fzfc2 first appeared (with stable ids) in SCOP 1.55
  
• d1fzfc2 appears in SCOP 1.73
  
• d1fzfc2 appears in SCOPe 2.01
  
• d1fzfc2 appears in the current release, SCOPe 2.08