Lineage for d1fzcf2 (1fzc F:97-141)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2590058Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2590756Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 2590757Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 2590869Protein Fibrinogen gamma chain [88898] (4 species)
  7. 2590878Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries)
    Uniprot P02679
  8. 2590881Domain d1fzcf2: 1fzc F:97-141 [45595]
    Other proteins in same PDB: d1fzca_, d1fzcb1, d1fzcb2, d1fzcc1, d1fzcd_, d1fzce1, d1fzce2, d1fzcf1
    coiled-coil region only
    complexed with ca, man, nag

Details for d1fzcf2

PDB Entry: 1fzc (more details), 2.3 Å

PDB Description: crystal structure of fragment double-d from human fibrin with two different bound ligands
PDB Compounds: (F:) fibrin

SCOPe Domain Sequences for d1fzcf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzcf2 h.1.8.1 (F:97-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]}
easilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckd

SCOPe Domain Coordinates for d1fzcf2:

Click to download the PDB-style file with coordinates for d1fzcf2.
(The format of our PDB-style files is described here.)

Timeline for d1fzcf2: