![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (29 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) ![]() |
![]() | Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
![]() | Protein Fibrinogen beta chain [88892] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries) |
![]() | Domain d1fzce2: 1fzc E:151-199 [45594] Other proteins in same PDB: d1fzca_, d1fzcb1, d1fzcc1, d1fzcc2, d1fzcd_, d1fzce1, d1fzcf1, d1fzcf2 coiled-coil region only complexed with ca, man, nag |
PDB Entry: 1fzc (more details), 2.3 Å
SCOP Domain Sequences for d1fzce2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzce2 h.1.8.1 (E:151-199) Fibrinogen beta chain {Human (Homo sapiens)} lyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv
Timeline for d1fzce2: