SCOP 1.67: Domain d1fzce2: 1fzc E:151-199

Lineage for d1fzce2 (1fzc E:151-199)

1. Root: SCOP 1.67

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.1: Parallel coiled-coil [57943] (27 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen beta chain [88892] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88895] (13 PDB entries)

8. Domain d1fzce2: 1fzc E:151-199 [45594]
   Other proteins in same PDB: d1fzca_, d1fzcb1, d1fzcc1, d1fzcc2, d1fzcd_, d1fzce1, d1fzcf1, d1fzcf2
   coiled-coil region only
   complexed with ca, man, nag

Details for d1fzce2

PDB Entry: 1fzc, 2.3 Å

PDB Description: crystal structure of fragment double-d from human fibrin with two different bound ligands

SCOP Domain Sequences for d1fzce2:

Sequence; same for both SEQRES and ATOM records:

>d1fzce2 h.1.8.1 (E:151-199) Fibrinogen beta chain {Human (Homo sapiens)}
lyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv

Timeline for d1fzce2:

• d1fzce2 first appeared (with stable ids) in SCOP 1.55
  
• d1fzce2 appears in SCOP 1.65
  
• d1fzce2 appears in SCOP 1.69
  
• d1fzce2 appears in the current release, SCOPe 2.08