Lineage for d1fzcd_ (1fzc D:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039948Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 3039949Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 3039950Protein Fibrinogen alpha chain [88887] (4 species)
  7. 3039959Species Human (Homo sapiens) [TaxId:9606] [88889] (22 PDB entries)
    Uniprot P02671 150-209
  8. 3039963Domain d1fzcd_: 1fzc D: [45593]
    Other proteins in same PDB: d1fzcb1, d1fzcb2, d1fzcc1, d1fzcc2, d1fzce1, d1fzce2, d1fzcf1, d1fzcf2
    coiled-coil region only
    complexed with ca, man, nag

Details for d1fzcd_

PDB Entry: 1fzc (more details), 2.3 Å

PDB Description: crystal structure of fragment double-d from human fibrin with two different bound ligands
PDB Compounds: (D:) fibrin

SCOPe Domain Sequences for d1fzcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzcd_ h.1.8.1 (D:) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]}
ievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdy
edqqkqleqviakd

SCOPe Domain Coordinates for d1fzcd_:

Click to download the PDB-style file with coordinates for d1fzcd_.
(The format of our PDB-style files is described here.)

Timeline for d1fzcd_: