Lineage for d1fzca1 (1fzc A:)

  1. Root: SCOP 1.61
  2. 205390Class h: Coiled coil proteins [57942] (5 folds)
  3. 205391Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
  4. 205752Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 205753Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein)
  6. 205754Protein Fibrinogen coiled-coil and central regions [58012] (4 species)
  7. 205775Species Human (Homo sapiens) [TaxId:9606] [58013] (6 PDB entries)
  8. 205776Domain d1fzca1: 1fzc A: [45590]
    Other proteins in same PDB: d1fzcb1, d1fzcc1, d1fzce1, d1fzcf1

Details for d1fzca1

PDB Entry: 1fzc (more details), 2.3 Å

PDB Description: crystal structure of fragment double-d from human fibrin with two different bound ligands

SCOP Domain Sequences for d1fzca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzca1 h.1.8.1 (A:) Fibrinogen coiled-coil and central regions {Human (Homo sapiens)}
ievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdy
edqqkqleqviakd

SCOP Domain Coordinates for d1fzca1:

Click to download the PDB-style file with coordinates for d1fzca1.
(The format of our PDB-style files is described here.)

Timeline for d1fzca1: