SCOP 1.55: Domain d1vdfd_: 1vdf D:

Lineage for d1vdfd_ (1vdf D:)

1. Root: SCOP 1.55
2. Class h: Coiled coil proteins [57942] (5 folds)
3. Fold h.1: Parallel coiled-coil [57943] (19 superfamilies)
4. Superfamily h.1.7: Assembly domain of cartilage oligomeric matrix protein [58006] (1 family)
5. Family h.1.7.1: Assembly domain of cartilage oligomeric matrix protein [58007] (1 protein)
6. Protein Assembly domain of cartilage oligomeric matrix protein [58008] (1 species)
7. Species Rat (Rattus norvegicus) [TaxId:10116] [58009] (2 PDB entries)
8. Domain d1vdfd_: 1vdf D: [45583]

Details for d1vdfd_

PDB Entry: 1vdf, 2.05 Å

PDB Description: assembly domain of cartilage oligomeric matrix protein

SCOP Domain Sequences for d1vdfd_:

Sequence; same for both SEQRES and ATOM records:

>d1vdfd_ h.1.7.1 (D:) Assembly domain of cartilage oligomeric matrix protein {Rat (Rattus norvegicus)}
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg

SCOP Domain Coordinates for d1vdfd_ are not available.

Timeline for d1vdfd_:

• d1vdfd_ appears in SCOP 1.57
  
• d1vdfd_ appears in the current release, SCOPe 2.08