Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) |
Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein) |
Protein Inovirus (filamentous phage) major coat protein [57989] (8 species) |
Species Bacteriophage pf3 [TaxId:10872] [57996] (1 PDB entry) |
Domain d1ifpa_: 1ifp A: [45570] |
PDB Entry: 1ifp (more details), 3.1 Å
SCOPe Domain Sequences for d1ifpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ifpa_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage pf3 [TaxId: 10872]} mqsvitdvtgqltavqadittiggaiivlaavvlgirwikaqff
Timeline for d1ifpa_: