Lineage for d1ifpa_ (1ifp A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039816Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) (S)
  5. 3039817Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein)
  6. 3039818Protein Inovirus (filamentous phage) major coat protein [57989] (8 species)
  7. 3039850Species Bacteriophage pf3 [TaxId:10872] [57996] (1 PDB entry)
  8. 3039851Domain d1ifpa_: 1ifp A: [45570]

Details for d1ifpa_

PDB Entry: 1ifp (more details), 3.1 Å

PDB Description: inovirus (filamentous bacteriophage) strain pf3 major coat protein assembly
PDB Compounds: (A:) major coat protein assembly

SCOPe Domain Sequences for d1ifpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ifpa_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage pf3 [TaxId: 10872]}
mqsvitdvtgqltavqadittiggaiivlaavvlgirwikaqff

SCOPe Domain Coordinates for d1ifpa_:

Click to download the PDB-style file with coordinates for d1ifpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ifpa_: