Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) |
Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein) |
Protein Inovirus (filamentous phage) major coat protein [57989] (8 species) |
Species Bacteriophage M13 [TaxId:10870] [57995] (2 PDB entries) |
Domain d2cpsa_: 2cps A: [45569] |
PDB Entry: 2cps (more details)
SCOPe Domain Sequences for d2cpsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cpsa_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage M13 [TaxId: 10870]} aegddpakaafnslqasateyigyawamvvvivgatigiklfkkftskas
Timeline for d2cpsa_: