Lineage for d2cpsa_ (2cps A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039816Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) (S)
  5. 3039817Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein)
  6. 3039818Protein Inovirus (filamentous phage) major coat protein [57989] (8 species)
  7. 3039831Species Bacteriophage M13 [TaxId:10870] [57995] (2 PDB entries)
  8. 3039832Domain d2cpsa_: 2cps A: [45569]

Details for d2cpsa_

PDB Entry: 2cps (more details)

PDB Description: solution nmr structures of the major coat protein of filamentous bacteriophage m13 solubilized in sodium dodecyl sulphate micelles, 25 lowest energy structures
PDB Compounds: (A:) m13 major coat protein

SCOPe Domain Sequences for d2cpsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cpsa_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage M13 [TaxId: 10870]}
aegddpakaafnslqasateyigyawamvvvivgatigiklfkkftskas

SCOPe Domain Coordinates for d2cpsa_:

Click to download the PDB-style file with coordinates for d2cpsa_.
(The format of our PDB-style files is described here.)

Timeline for d2cpsa_: