SCOPe 2.08: Domain d2cpba_: 2cpb A:

Lineage for d2cpba_ (2cpb A:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family)

5. Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein)

6. Protein Inovirus (filamentous phage) major coat protein [57989] (8 species)

7. Species Bacteriophage M13 [TaxId:10870] [57995] (2 PDB entries)

8. Domain d2cpba_: 2cpb A: [45568]

Details for d2cpba_

PDB Entry: 2cpb

PDB Description: solution nmr structures of the major coat protein of filamentous bacteriophage m13 solubilized in dodecylphosphocholine micelles, 25 lowest energy structures

PDB Compounds: (A:) m13 major coat protein

SCOPe Domain Sequences for d2cpba_:

Sequence; same for both SEQRES and ATOM records:

>d2cpba_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage M13 [TaxId: 10870]}
aegddpakaafnslqasateyigyawamvvvivgatigiklfkkftskas

Timeline for d2cpba_:

• d2cpba_ first appeared (with stable ids) in SCOP 1.55, called d2cpb__
  
• d2cpba_ appears in SCOPe 2.07