Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) |
Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein) |
Protein Inovirus (filamentous phage) major coat protein [57989] (8 species) |
Species Bacteriophage ike [TaxId:10867] [57993] (1 PDB entry) |
Domain d1ifla_: 1ifl A: [45566] mutant |
PDB Entry: 1ifl (more details), 5 Å
SCOPe Domain Sequences for d1ifla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ifla_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage ike [TaxId: 10867]} aepnaatnyateamdslktqaidlisqtwpvvttvvvaglvirlfkkfsskav
Timeline for d1ifla_: