Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) |
Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein) |
Protein Inovirus (filamentous phage) major coat protein [57989] (8 species) |
Species Bacteriophage fd [TaxId:10864] [57990] (7 PDB entries) |
Domain d1fdma_: 1fdm A: [45553] |
PDB Entry: 1fdm (more details)
SCOPe Domain Sequences for d1fdma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fdma_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage fd [TaxId: 10864]} aegddpakaafdslqasateyigyawamvvvivgatigiklfkkftskas
Timeline for d1fdma_: