Lineage for d1ifia_ (1ifi A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039816Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) (S)
  5. 3039817Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein)
  6. 3039818Protein Inovirus (filamentous phage) major coat protein [57989] (8 species)
  7. 3039819Species Bacteriophage fd [TaxId:10864] [57990] (7 PDB entries)
  8. 3039822Domain d1ifia_: 1ifi A: [45551]
    mutant

Details for d1ifia_

PDB Entry: 1ifi (more details), 3.3 Å

PDB Description: molecular models and structural comparisons of native and mutant class i filamentous bacteriophages ff (fd, f1, m13), if1 and ike
PDB Compounds: (A:) inovirus

SCOPe Domain Sequences for d1ifia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ifia_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage fd [TaxId: 10864]}
aegddpakaafdslqasateyigyawamvvvivgatigiklfkkftskas

SCOPe Domain Coordinates for d1ifia_:

Click to download the PDB-style file with coordinates for d1ifia_.
(The format of our PDB-style files is described here.)

Timeline for d1ifia_: