SCOPe 2.07: Domain d1g3fa1: 1g3f A:241-356

Lineage for d1g3fa1 (1g3f A:241-356)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein BIR domains of XIAP [57928] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57929] (15 PDB entries)
   Uniprot P98170 241-356

8. Domain d1g3fa1: 1g3f A:241-356 [45378]
   Other proteins in same PDB: d1g3fa2
   BIR3 domain complexed to a 9 residue peptide from smac/diablo
   complexed with zn

Details for d1g3fa1

PDB Entry: 1g3f

PDB Description: nmr structure of a 9 residue peptide from smac/diablo complexed to the bir3 domain of xiap

PDB Compounds: (A:) inhibitor of apoptosis protein 3

SCOPe Domain Sequences for d1g3fa1:

Sequence; same for both SEQRES and ATOM records:

>d1g3fa1 g.52.1.1 (A:241-356) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
sdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkc
fhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt

Timeline for d1g3fa1:

• d1g3fa1 first appeared (with stable ids) in SCOP 1.55, called d1g3fa_
  
• d1g3fa1 appears in SCOPe 2.06
  
• d1g3fa1 appears in the current release, SCOPe 2.08