Lineage for d1g3fa1 (1g3f A:241-356)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264524Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2264525Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2264526Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2264581Protein BIR domains of XIAP [57928] (1 species)
  7. 2264582Species Human (Homo sapiens) [TaxId:9606] [57929] (15 PDB entries)
    Uniprot P98170 241-356
  8. 2264618Domain d1g3fa1: 1g3f A:241-356 [45378]
    Other proteins in same PDB: d1g3fa2
    BIR3 domain complexed to a 9 residue peptide from smac/diablo
    complexed with zn

Details for d1g3fa1

PDB Entry: 1g3f (more details)

PDB Description: nmr structure of a 9 residue peptide from smac/diablo complexed to the bir3 domain of xiap
PDB Compounds: (A:) inhibitor of apoptosis protein 3

SCOPe Domain Sequences for d1g3fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3fa1 g.52.1.1 (A:241-356) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
sdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkc
fhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt

SCOPe Domain Coordinates for d1g3fa1:

Click to download the PDB-style file with coordinates for d1g3fa1.
(The format of our PDB-style files is described here.)

Timeline for d1g3fa1: