Lineage for d1g73c_ (1g73 C:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90881Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
  4. 90882Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 90883Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (3 proteins)
  6. 90893Protein BIR domains of XIAP [57928] (1 species)
  7. 90894Species Human (Homo sapiens) [TaxId:9606] [57929] (5 PDB entries)
  8. 90895Domain d1g73c_: 1g73 C: [45375]
    Other proteins in same PDB: d1g73a_, d1g73b_

Details for d1g73c_

PDB Entry: 1g73 (more details), 2 Å

PDB Description: crystal structure of smac bound to xiap-bir3 domain

SCOP Domain Sequences for d1g73c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g73c_ g.52.1.1 (C:) BIR domains of XIAP {Human (Homo sapiens)}
lprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsed
pweqhakwypgckylleqkgqeyinnihl

SCOP Domain Coordinates for d1g73c_:

Click to download the PDB-style file with coordinates for d1g73c_.
(The format of our PDB-style files is described here.)

Timeline for d1g73c_: