Class g: Small proteins [56992] (56 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (3 proteins) |
Protein BIR domains of XIAP [57928] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57929] (5 PDB entries) |
Domain d1g73c_: 1g73 C: [45375] Other proteins in same PDB: d1g73a_, d1g73b_ |
PDB Entry: 1g73 (more details), 2 Å
SCOP Domain Sequences for d1g73c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g73c_ g.52.1.1 (C:) BIR domains of XIAP {Human (Homo sapiens)} lprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsed pweqhakwypgckylleqkgqeyinnihl
Timeline for d1g73c_: