Lineage for d1adta3 (1adt A:386-529)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 894111Fold g.51: Zn-binding domains of ADDBP [57916] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 894112Superfamily g.51.1: Zn-binding domains of ADDBP [57917] (1 family) (S)
    duplication: contains two Zn-binding domains of similar fold
  5. 894113Family g.51.1.1: Zn-binding domains of ADDBP [57918] (2 proteins)
  6. 894122Protein Second Zn-domain of early E2A DNA-binding protein, ADDBP [57921] (1 species)
    Single-stranded DNA-binding protein
  7. 894123Species Human adenovirus type 5 [TaxId:28285] [57922] (4 PDB entries)
  8. 894124Domain d1adta3: 1adt A:386-529 [45368]
    Other proteins in same PDB: d1adta1, d1adta2
    complexed with zn

Details for d1adta3

PDB Entry: 1adt (more details), 2.6 Å

PDB Description: early e2a dna-binding protein
PDB Compounds: (A:) adenovirus single-stranded DNA-binding protein

SCOP Domain Sequences for d1adta3:

Sequence, based on SEQRES records: (download)

>d1adta3 g.51.1.1 (A:386-529) Second Zn-domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5 [TaxId: 28285]}
ghghllmplrcecnskpghapflgrqlpkltpfalsnaedldadlisdksvlasvhhpal
ivfqccnpvyrnsraqgggpncdfkisapdllnalvmvrslwsenftelprmvvpqfkws
tkhqyrnvslpvahsdarqnpfdf

Sequence, based on observed residues (ATOM records): (download)

>d1adta3 g.51.1.1 (A:386-529) Second Zn-domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5 [TaxId: 28285]}
ghghllmplrcecnsflgrqlpkltpfalsnaedldadlisdksvlasvhhpalivfqcc
npncdfkisapdllnalvmvrslwsenftelprmvvpqfkwstkhqyrnvslpvahsdar
qnpfdf

SCOP Domain Coordinates for d1adta3:

Click to download the PDB-style file with coordinates for d1adta3.
(The format of our PDB-style files is described here.)

Timeline for d1adta3:

  • d1adta3 first appeared (with stable ids) in SCOP 1.55, called d1adt_3
  • d1adta3 appears in SCOP 1.73
  • d1adta3 became obsolete in SCOPe 2.01