Lineage for d1dgza_ (1dgz A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1245730Fold g.42: Ribosomal protein L36 [57839] (1 superfamily)
    zinc-bound beta-ribbon motif
  4. 1245731Superfamily g.42.1: Ribosomal protein L36 [57840] (1 family) (S)
  5. 1245732Family g.42.1.1: Ribosomal protein L36 [57841] (1 protein)
  6. 1245733Protein Ribosomal protein L36 [57842] (3 species)
  7. 1245769Species Thermus thermophilus [TaxId:274] [57843] (10 PDB entries)
  8. 1245771Domain d1dgza_: 1dgz A: [45319]
    complexed with zn

Details for d1dgza_

PDB Entry: 1dgz (more details)

PDB Description: ribosmal protein l36 from thermus thermophilus: nmr structure ensemble
PDB Compounds: (A:) protein (l36 ribosomal protein)

SCOPe Domain Sequences for d1dgza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgza_ g.42.1.1 (A:) Ribosomal protein L36 {Thermus thermophilus [TaxId: 274]}
mkvrasvkricdkckvirrhgrvyvicenpkhkqrqg

SCOPe Domain Coordinates for d1dgza_:

Click to download the PDB-style file with coordinates for d1dgza_.
(The format of our PDB-style files is described here.)

Timeline for d1dgza_: