Lineage for d1gh9a_ (1gh9 A:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 751010Superfamily g.41.6: Hypothetical protein MTH1184 [57821] (1 family) (S)
    contains two CXC motifs
  5. 751011Family g.41.6.1: Hypothetical protein MTH1184 [57822] (1 protein)
    possible metal-binding fold
  6. 751012Protein Hypothetical protein MTH1184 [57823] (1 species)
  7. 751013Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [57824] (1 PDB entry)
  8. 751014Domain d1gh9a_: 1gh9 A: [45266]

Details for d1gh9a_

PDB Entry: 1gh9 (more details)

PDB Description: solution structure of a 8.3 kda protein (gene mth1184) from methanobacterium thermoautotrophicum
PDB Compounds: (A:) 8.3 kda protein (gene mth1184)

SCOP Domain Sequences for d1gh9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gh9a_ g.41.6.1 (A:) Hypothetical protein MTH1184 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
myiifrcdcgralysregaktrkcvcgrtvnvkdrrifgraddfeeaselvrklqeekyg
schftnpskre

SCOP Domain Coordinates for d1gh9a_:

Click to download the PDB-style file with coordinates for d1gh9a_.
(The format of our PDB-style files is described here.)

Timeline for d1gh9a_: