Lineage for d1ocos_ (1oco S:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204875Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 204959Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 205024Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
  6. 205025Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 205026Species Cow (Bos taurus) [TaxId:9913] [57820] (5 PDB entries)
  8. 205036Domain d1ocos_: 1oco S: [45265]
    Other proteins in same PDB: d1ocoa1, d1ocob1, d1ocob2, d1ococ1, d1ocod1, d1ocoe_, d1ocog1, d1ocoh_, d1ocoi1, d1ocoj1, d1ocok1, d1ocol1, d1ocom1, d1ocon1, d1ocoo1, d1ocoo2, d1ocop1, d1ocoq1, d1ocor_, d1ocot1, d1ocou_, d1ocov1, d1ocow1, d1ocox1, d1ocoy1, d1ocoz1

Details for d1ocos_

PDB Entry: 1oco (more details), 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state

SCOP Domain Sequences for d1ocos_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocos_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus)}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOP Domain Coordinates for d1ocos_:

Click to download the PDB-style file with coordinates for d1ocos_.
(The format of our PDB-style files is described here.)

Timeline for d1ocos_: