Lineage for d1occs_ (1occ S:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204875Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 204959Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 205024Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
  6. 205025Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 205026Species Cow (Bos taurus) [TaxId:9913] [57820] (5 PDB entries)
  8. 205032Domain d1occs_: 1occ S: [45261]
    Other proteins in same PDB: d1occa1, d1occb1, d1occb2, d1occc1, d1occd1, d1occe_, d1occg1, d1occh_, d1occi1, d1occj1, d1occk1, d1occl1, d1occm1, d1occn1, d1occo1, d1occo2, d1occp1, d1occq1, d1occr_, d1occt1, d1occu_, d1occv1, d1occw1, d1occx1, d1occy1, d1occz1

Details for d1occs_

PDB Entry: 1occ (more details), 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1occs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1occs_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus)}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOP Domain Coordinates for d1occs_:

Click to download the PDB-style file with coordinates for d1occs_.
(The format of our PDB-style files is described here.)

Timeline for d1occs_: