SCOP 1.55: Domain d1occs_: 1occ S:

Lineage for d1occs_ (1occ S:)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.41: Rubredoxin-like [57769] (8 superfamilies)

4. Superfamily g.41.5: Rubredoxin-like [57802] (3 families)

5. Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)

6. Protein Cytochrome c oxidase Subunit F [57819] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57820] (5 PDB entries)

8. Domain d1occs_: 1occ S: [45261]
   Other proteins in same PDB: d1occa1, d1occb1, d1occb2, d1occc1, d1occd1, d1occe_, d1occg1, d1occh_, d1occi1, d1occj1, d1occk1, d1occl1, d1occm1, d1occn1, d1occo1, d1occo2, d1occp1, d1occq1, d1occr_, d1occt1, d1occu_, d1occv1, d1occw1, d1occx1, d1occy1, d1occz1

Details for d1occs_

PDB Entry: 1occ, 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1occs_:

Sequence; same for both SEQRES and ATOM records:

>d1occs_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus)}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

Timeline for d1occs_:

• d1occs_ appears in SCOP 1.57
  
• d1occs_ appears in the current release, SCOPe 2.08