SCOP 1.67: Domain d1occf_: 1occ F:

Lineage for d1occf_ (1occ F:)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (3 families)

5. Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
   membrane-anchored rubredoxin-like domain

6. Protein Cytochrome c oxidase Subunit F [57819] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57820] (7 PDB entries)

8. Domain d1occf_: 1occ F: [45260]
   Other proteins in same PDB: d1occa_, d1occb1, d1occb2, d1occc_, d1occd_, d1occe_, d1occg_, d1occh_, d1occi_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occo2, d1occp_, d1occq_, d1occr_, d1occt_, d1occu_, d1occv_, d1occw_, d1occx_, d1occy_, d1occz_

Details for d1occf_

PDB Entry: 1occ, 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1occf_:

Sequence; same for both SEQRES and ATOM records:

>d1occf_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus)}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

Timeline for d1occf_:

• d1occf_ first appeared (with stable ids) in SCOP 1.55
  
• d1occf_ appears in SCOP 1.65
  
• d1occf_ appears in SCOP 1.69
  
• d1occf_ appears in the current release, SCOPe 2.08