SCOP 1.55: Domain d1ocrf_: 1ocr F:

Lineage for d1ocrf_ (1ocr F:)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.41: Rubredoxin-like [57769] (8 superfamilies)

4. Superfamily g.41.5: Rubredoxin-like [57802] (3 families)

5. Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)

6. Protein Cytochrome c oxidase Subunit F [57819] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57820] (5 PDB entries)

8. Domain d1ocrf_: 1ocr F: [45258]
   Other proteins in same PDB: d1ocra1, d1ocrb1, d1ocrb2, d1ocrc1, d1ocrd1, d1ocre_, d1ocrg1, d1ocrh_, d1ocri1, d1ocrj1, d1ocrk1, d1ocrl1, d1ocrm1, d1ocrn1, d1ocro1, d1ocro2, d1ocrp1, d1ocrq1, d1ocrr_, d1ocrt1, d1ocru_, d1ocrv1, d1ocrw1, d1ocrx1, d1ocry1, d1ocrz1

Details for d1ocrf_

PDB Entry: 1ocr, 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state

SCOP Domain Sequences for d1ocrf_:

Sequence; same for both SEQRES and ATOM records:

>d1ocrf_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus)}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

Timeline for d1ocrf_:

• d1ocrf_ appears in SCOP 1.57
  
• d1ocrf_ appears in the current release, SCOPe 2.08