Lineage for d2occs_ (2occ S:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41508Fold g.41: Rubredoxin-like [57769] (8 superfamilies)
  4. 41580Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 41638Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
  6. 41639Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 41640Species Cow (Bos taurus) [TaxId:9913] [57820] (5 PDB entries)
  8. 41642Domain d2occs_: 2occ S: [45257]
    Other proteins in same PDB: d2occa1, d2occb1, d2occb2, d2occc1, d2occd1, d2occe_, d2occg1, d2occh_, d2occi1, d2occj1, d2occk1, d2occl1, d2occm1, d2occn1, d2occo1, d2occo2, d2occp1, d2occq1, d2occr_, d2occt1, d2occu_, d2occv1, d2occw1, d2occx1, d2occy1, d2occz1

Details for d2occs_

PDB Entry: 2occ (more details), 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d2occs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2occs_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus)}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOP Domain Coordinates for d2occs_:

Click to download the PDB-style file with coordinates for d2occs_.
(The format of our PDB-style files is described here.)

Timeline for d2occs_: