SCOPe 2.08: Domain d2occs_: 2occ S:

Lineage for d2occs_ (2occ S:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
   membrane-anchored rubredoxin-like domain
   automatically mapped to Pfam PF01215

6. Protein Cytochrome c oxidase Subunit F [57819] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57820] (50 PDB entries)

8. Domain d2occs_: 2occ S: [45257]
   Other proteins in same PDB: d2occa_, d2occb1, d2occb2, d2occc_, d2occd_, d2occe_, d2occg_, d2occh_, d2occi_, d2occj_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occq_, d2occr_, d2occt_, d2occu_, d2occv_, d2occw_, d2occx_, d2occy_, d2occz_
   complexed with cu, hea, mg, na, per, zn

Details for d2occs_

PDB Entry: 2occ, 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state

PDB Compounds: (S:) cytochrome c oxidase

SCOPe Domain Sequences for d2occs_:

Sequence; same for both SEQRES and ATOM records:

>d2occs_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

Timeline for d2occs_:

• d2occs_ first appeared (with stable ids) in SCOP 1.55
  
• d2occs_ appears in SCOPe 2.07