Lineage for d2occf_ (2occ F:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244855Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1245023Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 1245185Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
    membrane-anchored rubredoxin-like domain
  6. 1245186Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 1245187Species Cow (Bos taurus) [TaxId:9913] [57820] (23 PDB entries)
  8. 1245218Domain d2occf_: 2occ F: [45256]
    Other proteins in same PDB: d2occa_, d2occb1, d2occb2, d2occc_, d2occd_, d2occe_, d2occg_, d2occh_, d2occi_, d2occj_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occq_, d2occr_, d2occt_, d2occu_, d2occv_, d2occw_, d2occx_, d2occy_, d2occz_
    complexed with cu, hea, mg, na, per, zn

Details for d2occf_

PDB Entry: 2occ (more details), 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (F:) cytochrome c oxidase

SCOPe Domain Sequences for d2occf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2occf_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOPe Domain Coordinates for d2occf_:

Click to download the PDB-style file with coordinates for d2occf_.
(The format of our PDB-style files is described here.)

Timeline for d2occf_: