SCOP 1.55: Domain d2occf_: 2occ F:

Lineage for d2occf_ (2occ F:)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.41: Rubredoxin-like [57769] (8 superfamilies)

4. Superfamily g.41.5: Rubredoxin-like [57802] (3 families)

5. Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)

6. Protein Cytochrome c oxidase Subunit F [57819] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57820] (5 PDB entries)

8. Domain d2occf_: 2occ F: [45256]
   Other proteins in same PDB: d2occa1, d2occb1, d2occb2, d2occc1, d2occd1, d2occe_, d2occg1, d2occh_, d2occi1, d2occj1, d2occk1, d2occl1, d2occm1, d2occn1, d2occo1, d2occo2, d2occp1, d2occq1, d2occr_, d2occt1, d2occu_, d2occv1, d2occw1, d2occx1, d2occy1, d2occz1

Details for d2occf_

PDB Entry: 2occ, 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d2occf_:

Sequence; same for both SEQRES and ATOM records:

>d2occf_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus)}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

Timeline for d2occf_:

• d2occf_ appears in SCOP 1.57
  
• d2occf_ appears in the current release, SCOPe 2.08