![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
![]() | Family g.41.5.1: Rubredoxin [57803] (5 proteins) |
![]() | Protein Rubrerythrin, C-terminal domain [57811] (2 species) |
![]() | Species Desulfovibrio vulgaris [TaxId:881] [57812] (10 PDB entries) Uniprot P24931 |
![]() | Domain d1b71a2: 1b71 A:148-191 [45246] Other proteins in same PDB: d1b71a1 complexed with fe, zn |
PDB Entry: 1b71 (more details), 1.9 Å
SCOPe Domain Sequences for d1b71a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b71a2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} flreqatkwrcrncgyvhegtgapelcpacahpkahfellginw
Timeline for d1b71a2: