Lineage for d1ryt_2 (1ryt 148-191)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 271305Fold g.41: Rubredoxin-like [57769] (10 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 271389Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 271390Family g.41.5.1: Rubredoxin [57803] (2 proteins)
  6. 271435Protein Rubrerythrin, C-terminal domain [57811] (1 species)
  7. 271436Species Desulfovibrio vulgaris [TaxId:881] [57812] (7 PDB entries)
  8. 271442Domain d1ryt_2: 1ryt 148-191 [45245]
    Other proteins in same PDB: d1ryt_1
    complexed with fe

Details for d1ryt_2

PDB Entry: 1ryt (more details), 2.1 Å

PDB Description: rubrerythrin

SCOP Domain Sequences for d1ryt_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryt_2 g.41.5.1 (148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris}
flreqatkwrcrncgyvhegtgapelcpacahpkahfellginw

SCOP Domain Coordinates for d1ryt_2:

Click to download the PDB-style file with coordinates for d1ryt_2.
(The format of our PDB-style files is described here.)

Timeline for d1ryt_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ryt_1