Lineage for d1qcva_ (1qcv A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641212Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2641213Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 2641222Protein Rubredoxin [57804] (8 species)
  7. 2641286Species Pyrococcus furiosus [TaxId:2261] [57809] (30 PDB entries)
    Uniprot P24297
  8. 2641322Domain d1qcva_: 1qcv A: [45241]
    variant pfrd-xc4 folds without iron

Details for d1qcva_

PDB Entry: 1qcv (more details)

PDB Description: rubredoxin variant (pfrd-xc4) folds without iron
PDB Compounds: (A:) protein (rubredoxin variant pfrd-xc4)

SCOPe Domain Sequences for d1qcva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcva_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
akwvlkitgyiydedagdpdngispgtkfeelpddwvapitgapksefekled

SCOPe Domain Coordinates for d1qcva_:

Click to download the PDB-style file with coordinates for d1qcva_.
(The format of our PDB-style files is described here.)

Timeline for d1qcva_: